PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035818001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CPP
Protein Properties Length: 1095aa    MW: 119355 Da    PI: 6.8025
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035818001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.73e-15573611341
                TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                        +k+CnCkkskClk+YC+Cfaag +C+e C C +C+N+ e
  GSVIVT01035818001 573 CKRCNCKKSKCLKLYCDCFAAGIYCAEGCACVGCFNRAE 611
                        79**********************************976 PP

2TCR49.49e-16658696139
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                        ++k+gCnCkks ClkkYCeC++a++ Cs  C+Ce+CkN 
  GSVIVT01035818001 658 RHKRGCNCKKSMCLKKYCECYQANVGCSAGCRCEGCKNV 696
                        589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-16571612IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.411572698IPR005172CRC domain
PfamPF036383.9E-11574609IPR005172CRC domain
SMARTSM011142.2E-17658699IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-11660695IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1095 aa     Download sequence    Send to blast
MFNKLSGWFD TTMDSPETAK TTTSTTKSSS QSPPLQVTTF PPIPPPETAA TTATSSSKSP  60
PVQDSPFSTY VSNLSPIKPV KAAHVAQEFP GLCSPPLVFT SPRINPHHET SFLKRTQCHH  120
VQFSTDNGRG KKVAAVSNIS DNANAQLNTG LVAKVEKECD IKDSVQDQPC SSSGCVDEYL  180
ADTMEADSAI SAHSAGSCLN QSNDALQSLQ SGFTDSNNTT ARFFDKKNIS VDKKRELDAS  240
PALLEQAEDE LQGKSAFNVK PVPTDGKQRG GERTSTEVLN VESNLSVDYA SEQLYESSVA  300
QFLFVKLCYN ISQDVKLQTA GGNQDELDCT PHLMPEALQI VRMDENCAQQ AGEISNGPVE  360
NTVLHDPEAS QQTQHQRGML RRCLQFGEAQ LNIITNNPSF SYPTSIAANS RLLATPSDSE  420
LPESSCVDLT TTSSNKQLAY SQPVTAMLPP QNSGNSSLAG SKPSGIGLHL NSIVNAVPMG  480
FSSTTSLKVE EKDYSSAWRI SDSIPSNVIE NSAGTEDRRN ENKASIAMSS ATSQSSHGIQ  540
PTKPKKEKAS LSFHVISHNF DFSASSTNDG DGCKRCNCKK SKCLKLYCDC FAAGIYCAEG  600
CACVGCFNRA EYDDRVLETR KQIESRNPLA FAPKIVPPVN GSPINSGEDG RSTPSSARHK  660
RGCNCKKSMC LKKYCECYQA NVGCSAGCRC EGCKNVYGRK EEYGAFKEMM SRRANDDRLE  720
SSFDKKLEMV AARSDFLRPE LCNPHNMTPM TPSFQCSDHG NDAANFQIPS RRYAQSPESD  780
FSILSSYGKS PVSPKNSDSH NILPEPGKEI WDMACYEHEF EYGNAEKVDQ FTPGSMNPSA  840
SSKTSGLTNV SRGQLCPGSD HLVSGGSLRW RSSPIPPSTQ LGETKIFQGL ESDNELYDIL  900
EDDTPTILKD ASTPTKAVKA SSPKQKRVSP PKIQSHERGS SSSLAILKSG RKFILQAVPS  960
FPPLTPCIDT KSSSHQNSSD PQDSIMDMGA KIAICRTLSC GLEDCVRIPS DNHLQGLMGK  1020
DGKRNLVRQL LLLIHVLFFL LFFFRIFEHF FLVQLHVSSN GNISQMVSFC WRYGSCYSFS  1080
RCIGFSHFLT NIEK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.292120.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4363680.0AM436368.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X217263.35, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282493.20.0PREDICTED: CRC domain-containing protein TSO1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.19e-61TESMIN/TSO1-like CXC 2